PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr000101.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family TALE
Protein Properties Length: 417aa    MW: 46229.5 Da    PI: 6.5429
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr000101.2genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.33e-093433772155
                  HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
     Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                  k +yps++++  LA+++gL+++q+ +WF N+R ++
  Pbr000101.2 343 KWPYPSESQKLALAESTGLDQKQINNWFINQRKRH 377
                  569*****************************885 PP

2ELK40.94.3e-14297318122
          ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                  ELK qLlrKYsgyLgsLkqEF+
  Pbr000101.2 297 ELKGQLLRKYSGYLGSLKQEFM 318
                  9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012558.5E-19119163IPR005540KNOX1
PfamPF037903.1E-22120159IPR005540KNOX1
SMARTSM012562.2E-26173224IPR005541KNOX2
PfamPF037911.8E-21177223IPR005541KNOX2
SMARTSM011882.8E-8297318IPR005539ELK domain
PfamPF037897.1E-11297318IPR005539ELK domain
PROSITE profilePS5121311.174297317IPR005539ELK domain
PROSITE profilePS5007112.989317380IPR001356Homeobox domain
SuperFamilySSF466891.28E-19319395IPR009057Homeodomain-like
SMARTSM003891.3E-12319384IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.0E-28322382IPR009057Homeodomain-like
CDDcd000862.73E-12329380No hitNo description
PfamPF059207.9E-17337376IPR008422Homeobox KN domain
PROSITE patternPS000270355378IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009934Biological Processregulation of meristem structural organization
GO:0048440Biological Processcarpel development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 417 aa     Download sequence    Send to blast
MEGGSNGTCS MMAFGESSSN GGGMMMMPLM TSSHHADHSH HHHHQHMNPN PYADAHNTST  60
THQLHQLPQL PPSNNHHDRH NTSGGSSFIL HNPAAASYFM DNNNNNEGVG GSSFSSSSST  120
VKAKIMAHPH YHRLLASYIN CQKVGAPPEV VARLEEACAS AATIGQMVSS SSGSGSLGED  180
PALDQFMEAY CEMLTKYEQE LSKPFKEAMI FLQRIESQFK ALTLSSSSDS AAVLATSSIL  240
DLDSLACLSE NYSVASGKLQ YQTNFEGYGE GIDRNNGSSE DEVDVNNFID PQAEDRELKG  300
QLLRKYSGYL GSLKQEFMKK RKKGKLPKEA RQQLLDWWSR HYKWPYPSES QKLALAESTG  360
LDQKQINNWF INQRKRHWKP TEDMQFVVMD ASHPGHYYMD SVMGNPFPMD ISPTLL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1312321LKQEFMKKRK
2318322KKRKK
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ3642321e-135DQ364232.1 Prunus dulcis homeodomain protein Kn1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009356665.10.0PREDICTED: homeobox protein knotted-1-like LET6
SwissprotP466081e-143HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLD3IWE90.0D3IWE9_PRUPE; Class I KNOX homeobox transcription factor STM-like 2
STRINGVIT_10s0116g00190.t011e-159(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-133KNOX/ELK homeobox transcription factor